PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G04580.1
Common NameF4H6.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 166aa    MW: 19215.8 Da    PI: 9.3426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G04580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.23.2e-271568255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 pr++Wt +L  rF++++e+LGG+e AtPk+il lm+v +Lt++hvkSHLQ+YR 
  AT4G04580.1 15 PRMHWTDDLDIRFIQVIEKLGGEESATPKRILSLMGVRDLTISHVKSHLQMYRN 68
                 9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-251170IPR009057Homeodomain-like
PROSITE profilePS5129411.8081171IPR017930Myb domain
SuperFamilySSF466891.79E-151372IPR009057Homeodomain-like
TIGRFAMsTIGR015577.9E-271470IPR006447Myb domain, plants
PfamPF002495.0E-91667IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MQDPMVRSYI RSDNPRMHWT DDLDIRFIQV IEKLGGEESA TPKRILSLMG VRDLTISHVK  60
SHLQMYRNKK KEESSKEIKM MREMTQRQSQ QYLQIYERAT QFIQNQQRLQ LDNTEKITPV  120
LGSSNKSLDQ SSKVGLNENR GNDVVVVGGA TGEEELSLEL TLGRKY
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184126120.0
Expression AtlasAT4G04580-
AtGenExpressAT4G04580-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G04580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G04580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0740217e-58AF074021.1 Arabidopsis thaliana BAC F4H6, chromosome IV, complete sequence.
GenBankAL1615017e-58AL161501.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 13.
GenBankCP0026877e-58CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192367.11e-120homeodomain-like superfamily protein
TrEMBLQ9XEB21e-120Q9XEB2_ARATH; Homeodomain-like superfamily protein
STRINGAT4G04580.11e-119(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Representative plantOGRP28515123
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]